PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00023747-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family FAR1
Protein Properties Length: 246aa    MW: 27685.6 Da    PI: 6.6873
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00023747-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR168.22.1e-2157138990
                   FAR1   9 evGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                            +vGF vr+ + ++s+ +g++  r++ C+k+g++ ++k     e+++r++ r gCka++  k+ek+gkw+vt++++eHnH+l+
  SMil_00023747-RA_Salv  57 HVGFVVRVMQRRRSEIDGRTLARRLGCNKQGFSPNTKGMIGPEKKPRPSAREGCKATILFKLEKSGKWVVTRFVKEHNHPLV 138
                            58***********************************999****************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.6E-1958138IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MLHVLRMDLV ASTVVEAAAG DSDKEDLNSR DSDEDDLAEA EEEKTWSGEG GEVVEPHVGF  60
VVRVMQRRRS EIDGRTLARR LGCNKQGFSP NTKGMIGPEK KPRPSAREGC KATILFKLEK  120
SGKWVVTRFV KEHNHPLVVT AQEDTNVVRP TPSSTHIYQL FQQKLPVLII RSRMQLDKDK  180
RIQELARELQ RQEELCAAYR ERLINLLSTI ESQADQMSSK VLAVVESVKK AEAEALTEAL  240
TIPLDK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012833525.11e-92PREDICTED: protein FAR1-RELATED SEQUENCE 12
TrEMBLA0A022RKY61e-92A0A022RKY6_ERYGU; Uncharacterized protein
STRINGGLYMA18G24443.13e-67(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA116022025
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G12850.11e-36FAR1 family protein